Now admitting founding brandsYour Concierge, get agent-readyA fashion and lifestyle a-commerce platformThis is the agentic webNow admitting founding brandsYour Concierge, get agent-readyA fashion and lifestyle a-commerce platformThis is the agentic web
Real Real Genuine
← Jenny's
Protein Cookie Trial Set, 6 pc, 3 Flavors, GF

Item #6292

Protein Cookie Trial Set, 6 pc, 3 Flavors, GF

From Jenny's

Agent-ready

A gluten-free trial set of six protein cookies, two each of three fan-favourite flavours: Double Chocolate, Matcha and Macadamia, and Breakfast Granola. Each cookie is about 8.5cm wide with roughly 10g of casein protein, made with organic rolled oats. A good way to sample before stocking up. Mirror of www.jennys.jp, checkout in USDC on Base, ships from Japan.

Agent contextWhat an AI buyer's agent reads

A gluten-free trial set of six protein cookies, two each of three fan-favourite flavours shown in the image: Double Chocolate, Matcha and Macadamia, and Breakfast Granola. Each cookie is about 50g with roughly 10g of casein protein on an organic rolled oat base, a low-commitment way to sample before stocking up. Mirror of www.jennys.jp, checkout in USDC on Base, ships from Japan with free shipping inside Japan.

gluten-freehigh-proteincasein-proteinoat-basedhealthy-snacknot-too-sweetjapaneseindividually-wrappedtrialsamplervarietypost-workoutbreakfastcoffee breakgymdesk snacktrying flavoursgift
Price
$12
USDC
Stock
1
across all sizes

Select size

1 in stock · 0 sold out

Choose a size to continue

Select a size above to continue